PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.CW3NA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 249aa    MW: 29507.9 Da    PI: 7.6819
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.CW3NAgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.6e-1856100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T+eE+e+l+  +  +G++ W+ Iar+++ gRt++ +k++w+  
      Aradu.CW3NA  56 RNPFTEEEEERLLASHSIHGNR-WSVIARHFP-GRTDNAVKNHWHVM 100
                      789*******************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM0071751352IPR001005SANT/Myb domain
PROSITE profilePS500904.054450IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.606.2E-12557IPR009057Homeodomain-like
SuperFamilySSF466893.53E-2239105IPR009057Homeodomain-like
PROSITE profilePS5129424.56451105IPR017930Myb domain
SMARTSM007172.3E-1655103IPR001005SANT/Myb domain
PfamPF002493.9E-155699IPR001005SANT/Myb domain
CDDcd001673.50E-1258101No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2158103IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MCTRGHWRPA EDEKLRELFL VCVFKLFDEE HQTANHVIRK SCRLRWFNQL DPRINRNPFT  60
EEEEERLLAS HSIHGNRWSV IARHFPGRTD NAVKNHWHVM MARIRRERSK VYAKRPLHHR  120
TFFSPNLQQQ QQEDHDDETT NFDTKNNISY CLVDKFHGKY SYPACLTYAT FQLPNKFHFQ  180
GPTSCATLLQ ERSQSIEFYD FLRVNTDSNK SEVSNNNGKK EDEEVNQDPV GHHNKDGIPF  240
IDFLSTQSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1921035106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016200869.11e-159PREDICTED: transcription factor MYB82-like
TrEMBLG7KJN35e-94G7KJN3_MEDTR; Myb transcription factor
STRINGGLYMA09G29940.17e-93(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.13e-66myb domain protein 52